PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g044766m
Common NameCISIN_1g044766mg, LOC102627868
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family LFY
Protein Properties Length: 399aa    MW: 44468.3 Da    PI: 7.8355
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g044766mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY637.32.4e-19413771385
            FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseap.....leaaaaaaark..lr.....eleelfkayGvryltvakiaelGftvstLvd 80 
                        mdpeaf+aslfkwdpr ++a+ppar++ e++ ++++     +    aaaa++  +r     +leelf+ayG+ry t+akiaelGftv+tL+d
  orange1.1g044766m   1 MDPEAFTASLFKWDPRVVVAPPPARVQLEQVSQPPAvplgaA----AAAAYSalVRprelgGLEELFQAYGIRYHTAAKIAELGFTVNTLLD 88 
                        9******************9***9999888776665443321....222222223366777******************************* PP

            FLO_LFY  81 mkdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeet.aldalsqeglseepvqeekeaagsggeglgea 171
                        mkdeeld++m+sl ++fr++llvGeryGikaavraerrrl+e++   +rr++ls+d++t a+dalsqeglseepvq+ keaagsgg+g   +
  orange1.1g044766m  89 MKDEELDEMMNSLGHLFRWELLVGERYGIKAAVRAERRRLDEDD--LRRRHFLSSDTTTnAVDALSQEGLSEEPVQQDKEAAGSGGGG--PW 176
                        ******************************************87..78888898887766************************9999..78 PP

            FLO_LFY 172 elvaaeekkseeekkkaskkkqkrkkkkelkseededeeeeededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefL 263
                        e++ ++        kk++ +k  r      ++  d + e+e+d+de g+g +g+erqrehPfivtepgevargkknGLDYLf+LyeqCr+fL
  orange1.1g044766m 177 EVAEKK--------KKQRGRKGPRP-----RKVVDVNLEDENDDDEYGGGCGGMERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCRDFL 255
                        776544........23311111111.....2345777888899999********************************************** PP

            FLO_LFY 264 lqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdi 355
                        +qvq+iakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdi
  orange1.1g044766m 256 IQVQNIAKERGEKCPTKVTNQVFRYAKKAGASYINKPKMRHYVHCYALHCLDEEASNALRRAFKERGENVGAWRQACYKPLVAIAARQGWDI 347
                        ******************************************************************************************** PP

            FLO_LFY 356 davfnahprLsiWYvPtkLrqLChlerska 385
                        da+fnahprL iWYvPt+LrqLCh+er+ a
  orange1.1g044766m 348 DAIFNAHPRLGIWYVPTRLRQLCHAERNGA 377
                        ***************************865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.6E-2041376IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MDPEAFTASL FKWDPRVVVA PPPARVQLEQ VSQPPAVPLG AAAAAAYSAL VRPRELGGLE  60
ELFQAYGIRY HTAAKIAELG FTVNTLLDMK DEELDEMMNS LGHLFRWELL VGERYGIKAA  120
VRAERRRLDE DDLRRRHFLS SDTTTNAVDA LSQEGLSEEP VQQDKEAAGS GGGGPWEVAE  180
KKKKQRGRKG PRPRKVVDVN LEDENDDDEY GGGCGGMERQ REHPFIVTEP GEVARGKKNG  240
LDYLFHLYEQ CRDFLIQVQN IAKERGEKCP TKVTNQVFRY AKKAGASYIN KPKMRHYVHC  300
YALHCLDEEA SNALRRAFKE RGENVGAWRQ ACYKPLVAIA ARQGWDIDAI FNAHPRLGIW  360
YVPTRLRQLC HAERNGAGAA ASSSVSAGAE HSVILKPY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1092163752161PROTEIN LEAFY
2vy2_A1e-1092163752161PROTEIN LEAFY
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3389760.0AY338976.1 Citrus sinensis LEAFY (LFY) gene, complete cds.
GenBankDQ9953470.0DQ995347.1 Citrus unshiu LEAFY (LFY) gene, complete cds.
GenBankDQ9953480.0DQ995348.1 Citrus maxima LEAFY (LFY) gene, complete cds.
GenBankDQ9953490.0DQ995349.1 Citrus reticulata LEAFY (LFY) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006436969.10.0hypothetical protein CICLE_v10033942mg
RefseqXP_006485166.10.0PREDICTED: floricaula/leafy homolog
SwissprotO040640.0FLLH_POPTR; Floricaula/leafy homolog
TrEMBLA0A067F3520.0A0A067F352_CITSI; Uncharacterized protein
TrEMBLV4VCY40.0V4VCY4_9R
STRINGPOPTR_0015s11820.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-149floral meristem identity control protein LEAFY (LFY)